PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g021500.2
Common NameMTR_1g021500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family B3
Protein Properties Length: 440aa    MW: 48676.8 Da    PI: 9.1104
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g021500.2genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3391.5e-122892372
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHH CS
               B3  3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkan 72
                     +++++s+ + ++ l lpk+f ++ +  k+ +  ++l+ + g +W++ l  + ++g++++t+GW++Fvk++
  Medtr1g021500.2 28 TQFLRSNDFDQQ-LALPKTFSNNVK--KKLPENVVLKGPGGVTWNIGL--TSRDGTFYFTQGWEQFVKDH 92
                     566677777665.*******85555..458889***************..*******************9 PP

2B334.43.8e-11298378386
                      EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
               B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                       ++ ps+v k+  +++p+k + +h  +  +s++++l+    ++W  k++y + ++   lt+GWk F+ +n+L+e D+++Fk  g
  Medtr1g021500.2 298 VTMRPSHVYKRFFVSFPNKWILNHLAP--SSQDVILRM-GKNEWLGKYCYHNIRNNGGLTGGWKYFALDNNLEEFDVCLFKPAG 378
                      5789*****************999655..566788776.779********77777778**********************9554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019369.22E-142295IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508638.96625117IPR003340B3 DNA binding domain
CDDcd100171.27E-112692No hitNo description
Gene3DG3DSA:2.40.330.102.2E-142692IPR015300DNA-binding pseudobarrel domain
PfamPF023622.1E-92792IPR003340B3 DNA binding domain
SMARTSM010191.5E-427117IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.5E-16293380IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.9E-14296378IPR015300DNA-binding pseudobarrel domain
SMARTSM010198.4E-4296389IPR003340B3 DNA binding domain
PROSITE profilePS508638.896296394IPR003340B3 DNA binding domain
PfamPF023621.9E-9298378IPR003340B3 DNA binding domain
CDDcd100171.20E-14299392No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MGLQNGGGCS RSWEEDIYWT HFQFIHFTQF LRSNDFDQQL ALPKTFSNNV KKKLPENVVL  60
KGPGGVTWNI GLTSRDGTFY FTQGWEQFVK DHFFERERLP FSVEKAAAYF VRKCGHAEAA  120
AQTEQGGGCS SKGRETNNSV DEVNTPSNGV DEGVSHEKSL HLNSIRVPFA VPSETTNGKT  180
SNAAVESATP EQLMSDAAVT ETEPTAVPSQ TTGKRTRRPV YAVPSVPSKK RGRPPRTSNS  240
QEKALNWVTD AGPAPASPKG SPKTQELYTS NRRPVTKDEI EKTLQVAQAA CTEESLLVTM  300
RPSHVYKRFF VSFPNKWILN HLAPSSQDVI LRMGKNEWLG KYCYHNIRNN GGLTGGWKYF  360
ALDNNLEEFD VCLFKPAGHL HDILILEMSI FRVVEEITPL TAVHSPGKKR GLSSTGKKRG  420
VKRTLTSAAQ TELEAIEGA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.33720.0flower| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1426100.0BT142610.1 Medicago truncatula clone JCVI-FLMt-21M9 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003589285.10.0plant-specific B3-DNA-binding domain protein
TrEMBLG7I5840.0G7I584_MEDTR; Plant-specific B3-DNA-binding domain protein
STRINGGLYMA17G36490.21e-149(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.11e-24B3 family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]